Protein Info for PfGW456L13_1002 in Pseudomonas fluorescens GW456-L13

Annotation: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details PF11872: DUF3392" amino acids 4 to 107 (104 residues), 114.2 bits, see alignment E=1.6e-37

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU5771)

Predicted SEED Role

"Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QG24 at UniProt or InterPro

Protein Sequence (107 amino acids)

>PfGW456L13_1002 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific (Pseudomonas fluorescens GW456-L13)
MDLVLDLLATVSRWSRSNLSEIALALVGCLLVLFGADFKGWVEQLLGSIAGALRVPLMSL
LCMIGSGAALIYATPWVVRGLSQFNNYSLAPVLLVVLVLIGVVADRR