Protein Info for PagCFBP13505_RS05215 in Pantoea agglomerans CFBP13505 P0401

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 4 to 360 (357 residues), 248.6 bits, see alignment E=7.9e-78 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 28.4 bits, see alignment (E = 2.5e-10) PF22638: FlgK_D1" amino acids 93 to 326 (234 residues), 250.3 bits, see alignment E=3.9e-78 PF21158: flgK_1st_1" amino acids 335 to 419 (85 residues), 88.8 bits, see alignment E=4e-29 PF06429: Flg_bbr_C" amino acids 508 to 548 (41 residues), 32.4 bits, see alignment 1.1e-11

Best Hits

Swiss-Prot: 58% identical to FLGK_SALTY: Flagellar hook-associated protein 1 (flgK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 95% identity to pva:Pvag_0884)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (549 amino acids)

>PagCFBP13505_RS05215 flagellar hook-associated protein FlgK (Pantoea agglomerans CFBP13505 P0401)
MSSIINSAMSGLSAAQAALSTTSNNISNYTVAGYSRQTTVLAQANSTLQGNSYYGNGVNI
TGVQREYDAFIATQLRGSSANYSAVSTQHSQISNIDDLLSTSTTSLSTSLQGFFTNLKNV
VSNANDPSARQSMLSNAQGLVSQFQTSAQYLNNMQNSVNADVDSSIKQVNTITSQIADLN
KQIGKLSTANGAAPNDLLDKRDQLVNTLNNVVGVTVSQQDGGYTVAMANGLTLVNGDKSH
DLVAMPSSSDPTRTTIGYVDKQAGNVEIPEKLITTGSLGGLLAFRTQDLDLAQNQLGQLA
AAFTTSFNDVHKQGFDSKGNQGVDFFNIGSPIVVGNSKNSTAASVTAEWTDTSALKASNY
TVSYDGNNWTATRASDSTTVTITPGTDASGNTTLSFDGLKLTVAGTPAPAAKDSFLVKPV
QNAINDMSVAITSESQVAAAGAVGGESDNRNAQKLLNLQDVKLVGGNATLSQAYATIVSS
VGNKTSSLETTSTTQKSVVSQLTQRQQSVSGVNLDEEYANLTKYQQYYMANAQVLQTAST
VFNALINIR