Protein Info for PP_5666 in Pseudomonas putida KT2440

Annotation: putative microcin B17-like processing protein, McbB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF27891: McbB" amino acids 4 to 284 (281 residues), 288.4 bits, see alignment E=3.5e-90 TIGR04424: McbB family protein" amino acids 5 to 283 (279 residues), 153.8 bits, see alignment E=3.9e-49

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWL7 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_5666 putative microcin B17-like processing protein, McbB family (Pseudomonas putida KT2440)
MKTLRVYNYEILNFDSDPMVFSSSGFTRITEPKIIRALQLIEESQSKYIQHHALEKILRK
VHLQPSSAMNFLKSLSIIGEPTDPPFFQHTLIYHDLEISDETKNLLESKHSGSLEIRQYS
EYTPHTTRKPTLFVFACTKLSPHSLKANYLNLLVSNPHCGATVGFISGNHFHLTEMHIPA
IGNPCAFCTLDRITHYEKLRASQHHWCKIWSFCCSSKLDLPKIHVDELQKSLIIGTIVSF
ISKLTKAPKSKTTQDQVLLSRTINLETGVTTEDPSVHWPLCQCRGVK