Protein Info for PP_5603 in Pseudomonas putida KT2440

Annotation: putative FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01494: FAD_binding_3" amino acids 5 to 147 (143 residues), 32.1 bits, see alignment E=2.2e-11 PF01134: GIDA" amino acids 6 to 141 (136 residues), 23.2 bits, see alignment E=1e-08 PF04820: Trp_halogenase" amino acids 75 to 341 (267 residues), 36.1 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to ppf:Pput_2304)

Predicted SEED Role

"Probable alkylhalidase homolog (EC 3.8.1.1)" (EC 3.8.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWF4 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PP_5603 putative FAD dependent oxidoreductase (Pseudomonas putida KT2440)
MAELRIVVLGAGPAGAATAIGLRRLGYSVTVVSEWRRFAAVEGVSQRVLEGLRHAGLGGA
LSQAAMPATRQVRWNGQHLQMNQEFLLDRQRFDQALREDLQRAGVSVVEGRVREVVQGGG
HHVRLDDGQVLTADFLVEARGRQAPLAADRLRGPETVSLLNVWQGSPGAPASAVESLEDG
WAWMARLEDGRCYWQVTQEAAGLPGKAGLAAYCVTLRGRSALVAELFDDQALIPAQVHAR
SSTAILAGECVGQDWIRVGDAAMAVDPLSGNGIFQSLSSALQAPVVINTLLRRPERAELA
RQFHQQRVEQLFLRFARIGRDFYAQEQSRVGQPFWARRQGWPDAQPLHEAPDWQAVRVER
RPVLRDGLVDEAEVVVTADQPLGVWHLQGVELAPVVRQIRSGRPVEAVLSGLAGEQQRSV
RRWLGEQGLV