Protein Info for PP_5538 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03863: ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system" amino acids 52 to 394 (343 residues), 495.4 bits, see alignment E=4.2e-153 PF13458: Peripla_BP_6" amino acids 60 to 362 (303 residues), 44.3 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3093)

Predicted SEED Role

"FIG00953323: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FW92 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PP_5538 putative ABC transporter, substrate-binding protein (Pseudomonas putida KT2440)
MRQPAHLALTCLLALAATLATPLAPAAQGQAAAPLHIRIGYLGYRPAAGPLLSNIIPEPG
DAGLQGAELAIVDSNSTGRFLKQQFQLTSANVDSPEALLQAARAQHDQGLRVFVVNAPAA
SLRALSAALPDSLLFNAGSPDDSLRSSQCLGNVLHSLPSRAMLADALAQFLVLRKWQRAL
LVVGQTPDDQAYAAALRRSVKRFGVQLVAEKTWTFDNDQRRSAQADMPLFTQTAEYDVVL
VADERGDFGEYLPYQTWYPRPVAGTQGLTPTGWHKTVETFGAAQLQKRFEAQAGRWMNDR
DFAAWMAVRSVASAASKLRLAEPRALQQLLLSEQLPLDGFKGRKLSYRPWNGELRQPIPL
VQPRALVSTSPQEGFLHPFNEMDSLGYDKPEVTCSYP