Protein Info for PP_5411 in Pseudomonas putida KT2440

Annotation: N-acetyl glucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 4 to 451 (448 residues), 652.6 bits, see alignment E=1.6e-200 PF01128: IspD" amino acids 5 to 131 (127 residues), 33.3 bits, see alignment E=1.5e-11 PF00483: NTP_transferase" amino acids 6 to 165 (160 residues), 52 bits, see alignment E=2.6e-17 PF12804: NTP_transf_3" amino acids 6 to 121 (116 residues), 79.4 bits, see alignment E=1.2e-25 PF02348: CTP_transf_3" amino acids 22 to 125 (104 residues), 25.9 bits, see alignment E=2.8e-09 PF25087: GMPPB_C" amino acids 260 to 342 (83 residues), 39.7 bits, see alignment E=1.3e-13 PF00132: Hexapep" amino acids 263 to 297 (35 residues), 30.4 bits, see alignment 7.8e-11 PF14602: Hexapep_2" amino acids 281 to 310 (30 residues), 19.2 bits, see alignment (E = 2.8e-07) amino acids 394 to 426 (33 residues), 17.5 bits, see alignment (E = 1e-06)

Best Hits

Swiss-Prot: 100% identical to GLMU_PSEPK: Bifunctional protein GlmU (glmU) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to ppf:Pput_5293)

MetaCyc: 56% identical to fused N-acetylglucosamine-1-phosphate uridyltransferase and glucosamine-1-phosphate acetyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine diphosphorylase. [EC: 2.7.7.23]; Glucosamine-1-phosphate N-acetyltransferase. [EC: 2.7.7.23, 2.3.1.157]

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88BX6 at UniProt or InterPro

Protein Sequence (455 amino acids)

>PP_5411 N-acetyl glucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyl transferase (Pseudomonas putida KT2440)
MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVVIGHGAELVR
ERLAADDLNFVMQDKQLGTGHAVAQALPALTADTVLVLYGDVPLIEVETLQRLLAKANDQ
QLGLLTVTLDDPTGYGRIVRDEQGKVTAIVEHKDANDAQKAIKEGNTGILALPAARLADW
MGRLSNNNAQGEYYLTDVIAMAVADGLVVATEQPHDAMEVQGANDRRQLSELERHYQLRE
GRRLMAQGVTLRDPARFDVRGEVSVGRDVLIDINVILEGKVVIEDDVQIGPNCVIKNTTL
RKGAVVKANSHLEGAVMGEGSDAGPFARLRPGSVLDAKAHVGNFVELKNAHLGEGAKAGH
LTYLGDAEIGARTNIGAGTITCNYDGANKFKTVMGEDVFIGSNNSLVAPVEIKAGATTAA
GSTITQAVEAGDLAVARARQRNISGWKRPEKIKKS