Protein Info for PP_5386 in Pseudomonas putida KT2440

Annotation: Probable copper RND efflux membrane fusion protein, CzcB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF19335: HMBD" amino acids 44 to 71 (28 residues), 36.6 bits, see alignment (E = 1.4e-12) PF25919: BSH_CusB" amino acids 124 to 240 (117 residues), 96.4 bits, see alignment E=2.7e-31 PF25869: 3HB_CusB" amino acids 159 to 207 (49 residues), 69.5 bits, see alignment 7e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 207 to 389 (183 residues), 127.3 bits, see alignment E=3.2e-41 PF25954: Beta-barrel_RND_2" amino acids 244 to 320 (77 residues), 108 bits, see alignment E=8.6e-35 PF25967: RND-MFP_C" amino acids 328 to 384 (57 residues), 28.3 bits, see alignment 5.7e-10 PF25975: CzcB_C" amino acids 330 to 388 (59 residues), 35.9 bits, see alignment 2.3e-12 PF11604: CusF_Ec" amino acids 417 to 484 (68 residues), 80.1 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to ppu:PP_5386)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88BZ7 at UniProt or InterPro

Protein Sequence (490 amino acids)

>PP_5386 Probable copper RND efflux membrane fusion protein, CzcB family (Pseudomonas putida KT2440)
MNSRSIGLITAIALAIGVGTGYWLGHPAQPAQAPAIATEQKPLYWYDPMYPQQHFPAPGK
SPFMDMQLVAKYAEEGTDPAEPAVQISQGVQQNLGVRLATVSRGRLQRTLQVSGVLAFDE
RDFSVLQARTAGFVERTYGRATGDVVAKGAPLADVLAPEWAGLQEEFLALRHLGDVQLLA
AARQRLLLAGMPGELVDRVARSGKVQNQVTLVAPSAGVIQALDLRPGMTVTPGATLARIN
GIANVWLEAAVPEAQASGLHEGQAVEAHLPAYPGETVQGKLTALLADADLQSRTLRLRIE
LPNKDGRLRPGMTAQVSLRPGENADDSLLLPAEAVIRTGKRDLVMVAEDQGRFRPIEVVL
GQENGGQVAILKGLQAGQKVVASGQFLIDSEASLKGIEATTASDSPPASQAPEPELHQAD
GRVVQIEGTQLTIDHGPFVTLGMPGMTMTFPVADPALVNGLKVGDRIRFGIRERDDGMII
EQINALEDQP