Protein Info for PP_5380 in Pseudomonas putida KT2440

Annotation: copper resistance protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 3 to 439 (437 residues), 673.5 bits, see alignment E=2.6e-206 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 5 to 32 (28 residues), 22.1 bits, see alignment (E = 1.4e-08) PF07732: Cu-oxidase_3" amino acids 55 to 163 (109 residues), 130.6 bits, see alignment E=4.8e-42 amino acids 581 to 666 (86 residues), 32 bits, see alignment E=1.7e-11 PF00394: Cu-oxidase" amino acids 172 to 345 (174 residues), 87.2 bits, see alignment E=2e-28 PF07731: Cu-oxidase_2" amino acids 552 to 668 (117 residues), 99.1 bits, see alignment E=2.8e-32

Best Hits

KEGG orthology group: None (inferred from 92% identity to ppu:PP_5380)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C03 at UniProt or InterPro

Protein Sequence (669 amino acids)

>PP_5380 copper resistance protein A (Pseudomonas putida KT2440)
MQSKTTRRSFVKGLAATGLLGGLGMWRAPVWAVTSPGQPNVLTGTDFDLYIGELPVNITG
TVRTAMAINGSIPGPILRWREGDTVTLRVRNRLQQDTSIHWHGIILPANMDGVPGLSFHG
IAPDGMYEYKFKVQQNGTYWYHSHSGFQEQVGVYGALVIDAKEPEPFTYDRDYVVMLSDW
TDEDPARVLSKLKKQSDYYNYHKRTVGDFVNDVSEMGWSAAVADRKMWAEMKMSPTDLAD
VSGYTYTYLMNGQAPDGNWTGVFKPGEKIRLRFINGSAMTYFDVRIPGLKMTVVAADGQH
VKRVAVDEFRIAVAETYDVIVEPEDEQAYTIFAQSMDRTGYSRGTLAVREGMQAAVPAVD
PRPLISMSDMGMDHGSMAGMDHGNMAGMDHSKMAGMDHGNMAGMDHSKMAGMDHGNMTGM
DHSKMAGMDHGSMAGMDHSKMAEMDHGGMAGMDHSKMAGMDQGGMADMDHSKMAGMDQGG
MADMDHSSMEGMGGAMQSHPASETNNPLVDMQTMSPTPKLDDPGIGLRNNGRRVLTYADL
RSTFIDPDGREPGRTIELHLTGHMEKFAWSFDGVKFSDAEPLRLKYGERLRITLVNDTMM
THPIHLHGMWSDLEDEDGNFMVRKHTIDMPPGSKRSYRVTADALGRWAYHCHLLFHMEMG
MFREVRVDE