Protein Info for PP_5373 in Pseudomonas putida KT2440

Annotation: Rieske 2Fe-2S family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 50 to 136 (87 residues), 63.9 bits, E=1e-21
• PF00848: Ring_hydroxyl_A
  • amino acids 199 to 389 (191 residues), 136.1 bits, E=1.6e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5373)

Predicted SEED Role

"Benzoate 1,2-dioxygenase (EC 1.14.12.10)" (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (2/2 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• meta cleavage pathway of aromatic compounds (5/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (6/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See Q88C10 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PP_5373 Rieske 2Fe-2S family protein (Pseudomonas putida KT2440)
MTVSTDSRLIPVHVLETVLAPIHEAHGLTNEFYTDQRYFELERDEVLGRNWACIGFASDL
PTNSYVKPVDFMGLPLLMMRNREGLVQVFHNVCSHRGVKLVQQAGEVQGVIRCPYHSWTY
DLNGGLKGTPHIGGINQHKDERFACEKHGLKALRTTIWMDMVFINLSGEAPALEEQLQPL
TERWTQFLGNDGMSLLRREANGGAMSIEVNCNWKLAVENYCEAYHLPWVHPSLNSYSRLE
DHYNIMFEEFAGQGSHAYNLSAVAGTHLPIFPSWPQDRLRTAEYVAFFPNVLLGIQADHA
FAMMLEPVAPGKTIEHLRLFYVGDEALDSRYDASRKAVMESWRVVFAEDIASVEGMQKGR
SSPGYSGGAFSPEMDLPTHYFHKWAARQLLDCAQRA