Protein Info for PP_5371 in Pseudomonas putida KT2440

Annotation: Rubredoxin/rubredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00301: Rubredoxin" amino acids 4 to 49 (46 residues), 73.8 bits, see alignment 1.7e-24 PF07992: Pyr_redox_2" amino acids 81 to 352 (272 residues), 192.9 bits, see alignment E=1.8e-60 PF00070: Pyr_redox" amino acids 220 to 299 (80 residues), 42.7 bits, see alignment E=1.4e-14 PF18113: Rbx_binding" amino acids 383 to 452 (70 residues), 69.4 bits, see alignment E=3.5e-23

Best Hits

KEGG orthology group: K05297, rubredoxin-NAD+ reductase [EC: 1.18.1.1] (inferred from 100% identity to ppu:PP_5371)

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.1

Use Curated BLAST to search for 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C12 at UniProt or InterPro

Protein Sequence (461 amino acids)

>PP_5371 Rubredoxin/rubredoxin reductase (Pseudomonas putida KT2440)
MKTWLCIICGLIYDEAKGWPDDGIAPGTRWEDVPEDWLCPECKVGKADFEMIELSTPIAA
VATAPVIQAQPLVAARPAQPVVIIGSGHAGYGLAQALRKAAPQLEIRVLTQESGHLYSKP
ALSIALAQGRTAAALATETPLAIEQRLGIRIYTGCKVERIDAQAQRLYTSLGEMDYGQLV
LASGASPVRLPIEGRAEALLSVNNLQDYQAFRQRLDGVRRVAILGDGLIGCEFANDLASN
GYQVRVIGLGAWPMERLLPEAAGQHLQQALSGLGVQWSLRTTLQCIEPDGEGYRLTLADG
QVVGADLVLSAVGLRPNLELALEAGLDCGRGIKVDAQLQTSQPGIYALGDCVEINGQLLP
YLAPINEGIRALAKTLLGQPTAAHYPLAPVTVKTPVVPLCLLTPPGGCEGQWRCDATSDG
LSAAFHDHAGALRGFVLLGRQAQMQRNTWLQNCQDTQQNVA