Protein Info for PP_5367 in Pseudomonas putida KT2440

Annotation: Transketolase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5367)

Predicted SEED Role

"Transketolase, C-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See Q88C16 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PP_5367 Transketolase domain protein (Pseudomonas putida KT2440)
MSLALHPTHNKSKSRDHNDYDDVWESQRSVGSGIQASTCDHVVDCRCDRRGFVRRVRTSD
RCGRSGSNHCLCACWRSDGAGNANAWRDGSVTAENHSIIGGLGEAVAGLLLRNGVTPTFR
QIALPDAFLDAGALPTLHDRYGISTDAVSAQIKAWL