Protein Info for PP_5366 in Pseudomonas putida KT2440

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 3 to 464 (462 residues), 549 bits, see alignment E=4.1e-169 PF07992: Pyr_redox_2" amino acids 4 to 328 (325 residues), 264.6 bits, see alignment E=7.4e-82 PF12831: FAD_oxidored" amino acids 5 to 68 (64 residues), 35.7 bits, see alignment E=4e-12 PF00890: FAD_binding_2" amino acids 5 to 41 (37 residues), 23.7 bits, see alignment 1.6e-08 PF01134: GIDA" amino acids 5 to 59 (55 residues), 23.8 bits, see alignment 1.3e-08 PF00070: Pyr_redox" amino acids 176 to 252 (77 residues), 77.4 bits, see alignment E=6.1e-25 PF02852: Pyr_redox_dim" amino acids 347 to 456 (110 residues), 144.2 bits, see alignment E=1e-45

Best Hits

Swiss-Prot: 97% identical to DLDH3_PSEPU: Dihydrolipoyl dehydrogenase 3 (lpd3) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to ppf:Pput_5274)

MetaCyc: 56% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C17 at UniProt or InterPro

Protein Sequence (466 amino acids)

>PP_5366 dihydrolipoyl dehydrogenase (Pseudomonas putida KT2440)
MKSYDVVIIGGGPGGYNAAIRAGQLGLSVACVEGRSTLGGTCLNVGCMPSKALLHASELY
EAASGDEFAHLGIEVKPTLNLAQMMKQKDESVTGLTKGIEYLFRKNKVEWIKGWGRLDGI
GKVVVKAEDGSETALQAKDIVIATGSEPTPLPGVTVDNQRIIDSTGALSLPQVPKHLVVI
GAGVIGLELGSVWRRLGSQVTVIEYLDRICPGTDTETAKTLQKALAKQGMVFKLGSKVTQ
ATAGADGVSLTLEPAAGGTAESLQADYVLVAIGRRPYTKGLNLESVGLEADKRGMLNNEH
HRTSVPGVWVIGDVTSGPMLAHKAEDEAVACIERIAGKPHEVNYNLIPGVIYTRPEMATV
GKTEEQLKAEGRAYKVGKFPFTANSRAKINHETEGFAKVIADAETDEVLGVHLVGPSVSE
MIGEFCVAMEFSASAEDIALTCHPHPTRSEALRQAAMNVDGMAMQI