Protein Info for PP_5340 in Pseudomonas putida KT2440

Annotation: Acetylpolyamine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00850: Hist_deacetyl
  • amino acids 28 to 336 (309 residues), 234.1 bits, E=1.2e-73

Best Hits

Swiss-Prot: 73% identical to APAH1_PSEAE: Acetylpolyamine amidohydrolase 1 (aphA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5340)

MetaCyc: 53% identical to acetylpolyamine amidohydrolase subunit (Mycoplana ramosa)
Acetylputrescine deacetylase. [EC: 3.5.1.62]

Predicted SEED Role

"Deacetylases, including yeast histone deacetylase and acetoin utilization protein" in subsystem Hydantoin metabolism

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.62

Sequence Analysis Tools

See Q88C43 at UniProt or InterPro

Protein Sequence (347 amino acids)

>PP_5340 Acetylpolyamine aminohydrolase (Pseudomonas putida KT2440)
MLTIYSDDHRLHHGRCELIDGKLMPCFEMPSRADHVLDQVKKRKLGDIQGPTDFGRAPLL
RVHSADYLDFFEGAWARWAALGQEGDLLPFTWPARTLRQVKPTGLHGELGYYSFDAGAPI
TAGTWQAAYSAAQVALTAQAAIQQGAHAAFALCRPPGHHAAGEVMGGYCYLNNAAIAAQA
FLDQGRRKVAILDVDYHHGNGTQDIFYSRDDVFFASIHGDPQDEFPFFLGYADETGEGAG
QGYNINYPLPAGSDWAAWSAALEDACKRIASYDADVLVISLGVDTFKDDPISQFKLDSPD
YLEMGKRIGQLGKPTLFVMEGGYAVEEIGINAVNVLEGFQRAQSGAR