Protein Info for PP_5317 in Pseudomonas putida KT2440

Annotation: Probable chorismate pyruvate-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04345: Chor_lyase
  • amino acids 11 to 180 (170 residues), 177 bits, E=2.6e-56
• PF01947: Rv2949c-like
  • amino acids 33 to 177 (145 residues), 25 bits, E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to UBIC_PSEPK: Probable chorismate pyruvate-lyase (ubiC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 100% identity to ppf:Pput_5225)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• spongiadioxin C biosynthesis (2/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (2/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

See Q88C66 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_5317 Probable chorismate pyruvate-lyase (Pseudomonas putida KT2440)
MSYESPQAAAVAWLPYSQLATDIDQPTLDWLFDEGSLTRRLTRLSIDHFSVTPLFEGWQP
LRDDECQALGIAAGAEGWVREVYLRGHGQPWVFARSVASRSALERGGLDLETLGSRSLGE
LLFCDQAFIRHPLEVCTYPQAWLPSEAAHAALWGRRSRFERNGLDLLVAEVFLPALWQAA
KEENR