Protein Info for PP_5310 in Pseudomonas putida KT2440

Annotation: junction-specific ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 PF17191: RecG_wedge" amino acids 11 to 171 (161 residues), 55.6 bits, see alignment E=1.2e-18 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 27 to 664 (638 residues), 740.6 bits, see alignment E=9e-227 PF04851: ResIII" amino acids 271 to 430 (160 residues), 37.6 bits, see alignment E=5.4e-13 PF00270: DEAD" amino acids 274 to 435 (162 residues), 85 bits, see alignment E=1.3e-27 PF00271: Helicase_C" amino acids 480 to 586 (107 residues), 67.9 bits, see alignment E=2.2e-22 PF19833: RecG_dom3_C" amino acids 615 to 676 (62 residues), 53.5 bits, see alignment 5.5e-18

Best Hits

Swiss-Prot: 59% identical to RECG_ECO57: ATP-dependent DNA helicase RecG (recG) from Escherichia coli O157:H7

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to ppu:PP_5310)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C73 at UniProt or InterPro

Protein Sequence (692 amino acids)

>PP_5310 junction-specific ATP-dependent DNA helicase (Pseudomonas putida KT2440)
MSELSKVPVTVLKGVGEAMAEKLAKVGLENLQDVLFHLPLRYQDRTRVVPIGQLRPGQDA
VIEGVVSGADVTMGKRRSLVVRLGDGSGVLTLRFYHFSNAQKEGLKRGTHLRCYGEARPG
ASGLEIYHPEYRALNGNEPPPPVEQTLTPIYPSTEGLTQQRLRLLCQQSLALLGPRSLPD
WLPDELARDYQLAPLDEAIRYLHNPPADADLDELAEGQHWAQHRLAFEELLTHQLSQQRL
RESLRSLRAPVLPRATRLQAQYLANLGFQPTGAQQRVANEIAYDLSQHEPMMRLVQGDVG
AGKTVVAALAALQALEAGYQVALMAPTEILAEQHYITFKRWLEPLGIEVAWLAGKLKGKA
RAASLEQIANGAPMVVGTHALFQEEVRFKHLALAIIDEQHRFGVQQRLALRRKGVAGELC
PHQLIMTATPIPRTLAMSAYADLDTSVLDELPPGRTPVNTVLVADSRRFEVVERVRAACA
EGRQAYWVCTLIEESEELTCQAAESTYEELGSALGELKVGLIHGRMKPAEKAEIMAEFKA
GNLQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSAVSHCVLLYHPP
LSQIGRERLGIMRETNDGFIIAEKDLELRGPGEMLGTRQTGLLQFKVADLMRDADLLPAV
RDAAQALVSRWPEHVSPLLDRWLRHGQQYGQV