Protein Info for PP_5260 in Pseudomonas putida KT2440

Updated annotation (from data): 2-oxoadipate decarboxylase/hydroxylase (2-hydroxyglutarate synthase)
Rationale: Specifically important in carbon source L-Lysine; carbon source D-Lysine. This is part of the pathway from D-lysine to 2-oxoglutarate. For biochemical evidence that this enzyme forms 2-hydroxyglutarate, see https://doi.org/10.1101/450254
Original annotation: metalloprotein, putative enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF07063: HGLS" amino acids 16 to 411 (396 residues), 545.1 bits, see alignment E=6e-168

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_5170)

MetaCyc: 100% identical to 2-oxoadipate dioxygenase/decarboxylase (Pseudomonas putida KT2440)
RXN-21282 [EC: 1.13.11.93]

Predicted SEED Role

"FIG00960493: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.93

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CC1 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PP_5260 2-oxoadipate decarboxylase/hydroxylase (2-hydroxyglutarate synthase) (Pseudomonas putida KT2440)
MPANDFVSPDSIRAQFSAAMSLMYKQEVPLYGTLLELVSEINQQVMAQQPEVAEALRWTG
EIERLDQERHGAIRVGTAEELATIARLFAVMGMQPVGYYDLSSAGVPVHSTAFRAVHEQS
LHVSPFRVFTSLLRLELIDNPQLRELAQSILAKRQIFTSRALELIAQCEREGGLDAADAE
TFVQEALHTFRWHQDATVTAEQYQQLHDQHRLIADVVAFKGPHINHLTPRTLDIDAIQLG
MPAKGIPPKAVVEGPPTRRHPILLRQTSFKALQETVAFRDQQGREGSHTARFGEIEQRGA
ALTPKGRQLYDKLLDATRVALGGAPAEANAERYMALLQANFAEFPDDLAQMREQGLAYFR
YFATEKGLAARDQEGRPTTLQGLIDAGHVHFEALVYEDFLPVSAAGIFQSNLGDDAQAEY
GSNANREAFEAALGLQVQDELALYAQSERRSLQACAQALNLGSM