Protein Info for PP_5256 in Pseudomonas putida KT2440

Annotation: Cyclic nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 153 to 219 (67 residues), 55 bits, see alignment E=7.2e-19 PF00027: cNMP_binding" amino acids 349 to 434 (86 residues), 45.8 bits, see alignment E=4.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5256)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CC5 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PP_5256 Cyclic nucleotide-binding protein (Pseudomonas putida KT2440)
MLAFIQSSPLLLGCALILLDLVLWQLIPIQRHAWRISARLVIFLLFSSVLMAAGMSPLQP
PPWPDDVSRNLMATVLAIGWWLFGARTVTVVFGLLLVARGSHGGRLLQDVLGALIFLAAV
VAAAGYVLQLPVKGLLATSGVMAIVIGLALQSTLADVFSGIVLNTTRPYQIGDSISIDGT
EGKVLDIDWRATRLLTGTGSLAVIPNSVAAKARLLNHSRPADVHGVSISVVVPAKVRPKR
VFDALEKALQGVSAILATPKPKVTVKASTLESVEYEASGFVADAGAKGDARNQLFDLAHR
HLEASGVMWNVDLAVPPRSRQREVLDEVRVFRSLSDEERDALSQRMTAVEYLADQVILGV
GEHSDHLLVIGSGVVSASVREGDKLLEAGRMGPGEVLGIEGIIDEEDSLAEFRTLTSCVL
YRIDKEQVKSCLQQRGEVQTALSKLQRFRRQSRESLLLQKPASIKKGGFLSWLHK