Protein Info for PP_5253 in Pseudomonas putida KT2440

Annotation: Arylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00561: Abhydrolase_1" amino acids 21 to 256 (236 residues), 128.4 bits, see alignment E=1.1e-40 PF12697: Abhydrolase_6" amino acids 23 to 263 (241 residues), 83.2 bits, see alignment E=1.3e-26 PF12146: Hydrolase_4" amino acids 23 to 253 (231 residues), 75.3 bits, see alignment E=1.5e-24 PF00326: Peptidase_S9" amino acids 210 to 272 (63 residues), 23.7 bits, see alignment E=9.2e-09

Best Hits

Swiss-Prot: 81% identical to ESTE_PSEFL: Arylesterase from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_5163)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CC8 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PP_5253 Arylesterase (Pseudomonas putida KT2440)
MSTFVTRDGTSIYFKDWGSGKPVLFSHGWPLDADMWDSQMEFLASRGYRAIAFDRRGFGR
SSQPWNGYDYDTFADDIAQLIEHLDLRDVTLVGFSMGGGDVSRYIARHGSERVAGLVLLG
AVTPVFGKRDDNPDGVDLSVFEGIRAGLRADRAQFIADFATPFYGLNHGQQVSQGVQTQT
LNIALMASIKGTLDCVTAFSETDFRPDMAKVDVPTLVIHGDDDQIVPFETTGKQAAELIR
GAELKVYAGAPHGFAVTHAQQLNEDLLAFLQR