Protein Info for PP_5246 in Pseudomonas putida KT2440

Annotation: glutathione-regulated potassium/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 15 to 286 (272 residues), 289.7 bits, see alignment E=1.3e-90 PF00999: Na_H_Exchanger" amino acids 17 to 379 (363 residues), 209.2 bits, see alignment E=1.4e-65 PF02254: TrkA_N" amino acids 409 to 520 (112 residues), 83.7 bits, see alignment E=1.9e-27 PF27452: KefB_C" amino acids 528 to 594 (67 residues), 59.9 bits, see alignment E=3.6e-20

Best Hits

Swiss-Prot: 45% identical to KEFB_PECCP: Glutathione-regulated potassium-efflux system protein KefB (kefB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 100% identity to ppf:Pput_5156)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CD5 at UniProt or InterPro

Protein Sequence (595 amino acids)

>PP_5246 glutathione-regulated potassium/H+ antiporter (Pseudomonas putida KT2440)
MPHEGSLLQTAVIFLLAAVLAVPLAKRLQLGAVLGYLLAGVVIGPQALGLIRDTESVAHI
SELGVVLLLFIIGLELSPKRLWLMRKSVFGVGTAQVVLTGAVIGAIALFGFSQTLPAAIV
LGLGLALSSTALGLQSLAESKQLNAPHGRLAFAILLFQDIAAIPLIALVPLLAASGPDTS
QGDSLQHGLKVFASIAVVIIGGRYLLRPVFRTVARTGLPEVSTATALLVVIGTAWLMEEA
GISMALGAFLAGLLLADSEYRHELESQIEPFKGLLLGLFFISVGMGANLRLLLEMPLVVL
GLTLLLVAVKLLLLIGVGRLVGGLNSASALRLGMVLAAGGEFAFVVFKLGKDQGLFDTQT
YDLLLMTITLSMAITPLLMLGCARALKRPQPAREVPEQYKQIQTDTPRVVIVGMGRMGQI
VARILRAQKIPFIALETSVDTIEMTRMFEQVPVFYGDPLRPEVLHAAKVGEAEYFIITID
DPEAAIHTAARVKRLYPHLKVLARARNRQHVHKLADVGAEPIRETFYSSLEMTRRALVGL
GLSDEQAADRIARFTQHDEEVLEAQGQVRDDRAKVMQTAKEARVELERLFDSDAD