Protein Info for PP_5241 in Pseudomonas putida KT2440

Annotation: DNA-binding response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00486: Trans_reg_C" amino acids 20 to 91 (72 residues), 58.6 bits, see alignment E=1e-19 PF00072: Response_reg" amino acids 127 to 236 (110 residues), 78.9 bits, see alignment E=6.5e-26 PF08281: Sigma70_r4_2" amino acids 256 to 301 (46 residues), 32.8 bits, see alignment 9e-12 PF00196: GerE" amino acids 262 to 316 (55 residues), 56.2 bits, see alignment E=4.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5241)

Predicted SEED Role

"Signal transduction response regulator / Transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CE0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_5241 DNA-binding response regulator, LuxR family (Pseudomonas putida KT2440)
MIRIGNAQVSLERREVFVDGKPILLGGRAFDVLATLIRAKGRVVGKDELFSQVWSGTVVE
DNNLQVQVSLLRKAFGDRGLIQTVPRRGYRLAAQISLEEPGEALGRSLLRSLAETVEPLD
ERVNVPVLVVDDDSSVRTALGRLLRSQDIPHHLFASAEALFEARLETPCACLLLDMHLPG
TSGLEVQDALCRLALPWPIVFMTGFGTIPMTVQAMRAGAVEFLTKPFDEDQLLTLLQTVR
ARAVAEGHKWLQARQVEEKYQRLTQRERQVFSLVVGGLSHKQIARQIGTSEVTTKVHKKN
IMNKMQSRSLLELAAMHNLLGARSASLGGA