Protein Info for PP_5239 in Pseudomonas putida KT2440

Annotation: putative ATP-dependent chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 TIGR00368: Mg chelatase-like protein" amino acids 6 to 492 (487 residues), 634.8 bits, see alignment E=4.8e-195 PF05362: Lon_C" amino acids 19 to 145 (127 residues), 24.3 bits, see alignment E=7.6e-09 PF13541: ChlI" amino acids 21 to 142 (122 residues), 147.6 bits, see alignment E=5.6e-47 PF01078: Mg_chelatase" amino acids 190 to 391 (202 residues), 317 bits, see alignment E=1.7e-98 PF07728: AAA_5" amino acids 213 to 348 (136 residues), 31.9 bits, see alignment E=4.2e-11 PF00493: MCM" amino acids 287 to 389 (103 residues), 28.5 bits, see alignment E=2.8e-10 PF13335: Mg_chelatase_C" amino acids 400 to 492 (93 residues), 103.8 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to ppu:PP_5239)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CE2 at UniProt or InterPro

Protein Sequence (496 amino acids)

>PP_5239 putative ATP-dependent chelatase (Pseudomonas putida KT2440)
MSLALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLKY
PQRRITQNLAPADLPKDGGRYDLAIALGILAADGQVPIATLTDMECLGELALSGKLRPVQ
GVLPAALAAREAGRALVVPRENAEEASLAGGLVVYAVGHLLELVAHLNGQVPLPPYAANG
LILQQRPYPDLSEVQGQLAAKRALLLAAAGAHNLLFTGPPGTGKTLLASRLPGLLPPLDE
HEALEVAAIQSVSGKAPLNSWPQRPFRHPHHSASGPALVGGSSRPQPGEITLAHHGVLFL
DELPEFERRVLEVLREPLESGEIVIARARDKVRFPARFQLVAAMNPCPCGYLGDPTGRCR
CSTEQIARYRNKLSGPLLDRIDLHLTVARESTTLNNQPCGETSADVAARVAEARELQHRR
QGCANAFLDLEGLRHHCGLVAADQVWLEGACERLTLSLRAAHRLLKVARTLADLEGCETI
GRAHLAEALQYRPGSS