Protein Info for PP_5233 in Pseudomonas putida KT2440

Annotation: ammonium transporter AmtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 34 to 441 (408 residues), 483 bits, see alignment E=3.7e-149 PF00909: Ammonium_transp" amino acids 36 to 441 (406 residues), 403.4 bits, see alignment E=4.8e-125

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to ppf:Pput_5142)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CE8 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_5233 ammonium transporter AmtB (Pseudomonas putida KT2440)
MTLRKIAGLGALLSLVMPGLALAEEAAPALNSGDTAWMLTATALVLFMTIPGLALFYGGM
VRSKNVLSVMMQCFAITGLMSILWVVYGYSMAFDTAGMEKGVLNFNSFVGGFSKAFLSGV
TPDSLTSATALFPEAVFITFQMTFAIITPALIVGAFAERMKFSAMLVFMGIWFTLVYAPI
AHMVWSGDGALMWDWGVLDFAGGTVVHINAGIAGLVCCLVLGKRKGYPTTPMAPHNLGYT
LMGAAMLWIGWFGFNAGSAAAANGTAGMAMLVTQIATAAAALGWMFAEWVGHGKPSALGI
ASGVVAGLVAITPAAGTVGPIGALIIGLVSGVLCYFCATTLKRKLGYDDSLDAFGVHGVG
GIIGAILTGVFAAPALGGFGTVTDIGMQVWIQAKGVIFTVVYTAIVTYVILKVLDVVMGL
RVNEEEESVGLDLAQHNERGYNL