Protein Info for PP_5218 in Pseudomonas putida KT2440

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 22 to 137 (116 residues), 53.3 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_5127)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CG3 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PP_5218 DedA family protein (Pseudomonas putida KT2440)
MLQQFLQDFGYFALFLGTFFEGETILVLAGFLAFRGYMDINLVCLVAFFGSYAGDQLWYF
MGRRHGRRILARKPRWQAMGDRALDHIRRHPDIWVLSFRFVYGLRTVMPVAIGLSGYPPR
RYLLLNGIGAGVWAVALGAAAYHFGAILEGLLGNVKRYELWVLGGLVALGGLLWLRRRFR
TLRAERRAASQAQPPEAEQAVSHEQKPGQRHDHR