Protein Info for PP_5212 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, iron-sulfur-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 3 to 70 (68 residues), 40.7 bits, E=1.9e-14
• PF00175: NAD_binding_1
  • amino acids 197 to 297 (101 residues), 59.7 bits, E=4.3e-20

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 100% identity to ppf:Pput_5121)

Predicted SEED Role

No annotation

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (1/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (1/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

See Q88CG9 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PP_5212 Oxidoreductase, iron-sulfur-binding (Pseudomonas putida KT2440)
MQVTLQPSGAVLALEPGERILDGARRLGYDCPNSCRNGNCHVCAALLVEGRVRQDGEVRD
HGELFTCIAEPLEDCVLLWDGVLALGELPVRKLACSVSECVDVGGDVWRVRLRAPAGKPL
RYHAGQYLMIEREGGKQAAFSLASAPHAGRELELHVLAREPSAVQLIDQLRRDGLARIEM
PFGDTHLAELPDGPLVLIAAGTGMGQMHSLVEHCRAQGFKHPVHLYWGVRRPEDFYQIEH
WDEWQRLPNLFLHQVVSDLCGWEGRCGMLHEAVCEDIADLNSVHVYASGSPNMIYATLDA
LVEAGMDAHRMRADVFAYAPRG