Protein Info for PP_5210 in Pseudomonas putida KT2440

Annotation: Alcohol dehydrogenase, zinc-containing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 248 to 267 (20 residues), see Phobius details PF08240: ADH_N" amino acids 27 to 109 (83 residues), 62 bits, see alignment E=8.4e-21 PF00107: ADH_zinc_N" amino acids 151 to 269 (119 residues), 108.2 bits, see alignment E=4.4e-35 PF13602: ADH_zinc_N_2" amino acids 184 to 322 (139 residues), 85.5 bits, see alignment E=9.5e-28

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to ppf:Pput_5119)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CH1 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PP_5210 Alcohol dehydrogenase, zinc-containing (Pseudomonas putida KT2440)
MKAVLCKTLGPARNLVLEEVASPLPKKNEILLDVQAAGVNFPDTLIIEGKYQFQPPLPFS
PGGEAAGVVAAVGEKAGAFKVGDRVMALTGWGAFAEQVAVPFYNVLPIPASMDFTTAAAF
GMTYGTSMHALRQRGQLQAGETLLVLGASGGVGLAAVEIGKAMGARVIAAASSAEKLAVA
KAAGADELIDYSQANLREEIKRLTGGQGVDVIYDPVGGELFEQAVRGLAWNGRLLVVGFA
SGSIPQLAANLVLLKGAAVLGVFWGAFAQRQPEDNAANFHQLFAWHAEGKLKPLVSQTYP
LAEAGVAIEKLGQRQAVGKLVVLAR