Protein Info for PP_5200 in Pseudomonas putida KT2440

Annotation: proline aminopeptidase P II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details transmembrane" amino acids 34 to 34 (1 residues), see Phobius details PF05195: AMP_N" amino acids 9 to 128 (120 residues), 135.3 bits, see alignment E=9e-44 PF00557: Peptidase_M24" amino acids 183 to 414 (232 residues), 225 bits, see alignment E=9.1e-71

Best Hits

KEGG orthology group: K01262, Xaa-Pro aminopeptidase [EC: 3.4.11.9] (inferred from 99% identity to ppf:Pput_5107)

Predicted SEED Role

"Xaa-Pro aminopeptidase (EC 3.4.11.9)" (EC 3.4.11.9)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.9

Use Curated BLAST to search for 3.4.11.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CI1 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PP_5200 proline aminopeptidase P II (Pseudomonas putida KT2440)
MSHIPKAEYARRRKALMAQMVPNSIAILPAAAVAIRNRDVEHVYRQDSDFQYLSGFPEPE
AVIALIPGREHGEYVLFCRERNPERELWDGLRAGQEGAVRDFGADDAFPITDIDEILPGL
IEGRERVYSAMGSNPEFDRRLMDWINVIRSKARLGAQPPNEFVALDHLLHDMRLYKSAAE
VKVMRAAADISARAHVRAMQACRAGLHEYSLEAELDYEFRKGGARMPAYGSIVAAGRNGC
ILHYQQNDAPLKDGDLVLIDAGCEIDCYASDITRTFPVSGRFSPEQKAIYELVLKAQAAA
FAEIAPGKHWNHAHEATVRVITAGLVELGLLEGDVQALIESEAYRAFYMHRAGHWLGMDV
HDVGEYKVGGEWRVLEPGMALTVEPGIYIGADNQAVAKKWRGIGVRIEDDVVVTRQGCEI
LTSGVPRTVAEIEALMQAARKAVA