Protein Info for PP_5196 in Pseudomonas putida KT2440

Annotation: putative iron(III)|iron ABC transporter, periplasmic iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 27 to 282 (256 residues), 49.7 bits, see alignment E=8.7e-17 PF01547: SBP_bac_1" amino acids 32 to 279 (248 residues), 74.4 bits, see alignment E=3.5e-24 PF13416: SBP_bac_8" amino acids 41 to 307 (267 residues), 86.6 bits, see alignment E=5.4e-28 PF13343: SBP_bac_6" amino acids 74 to 298 (225 residues), 73.3 bits, see alignment E=4.4e-24

Best Hits

Swiss-Prot: 84% identical to P5217_PSEAE: Probable binding protein component of ABC iron transporter PA5217 (PA5217) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_5103)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CI5 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PP_5196 putative iron(III)|iron ABC transporter, periplasmic iron-binding protein (Pseudomonas putida KT2440)
MLPRKPLLAALALTLFGGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEA
PLMQRIKAEGDNGVADLLLTVDAGNLWQAEQMGILQPIESDVIDQNIPAQYRASSHDWTG
LSLRARTIIYSTERVKPEELSTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAK
TEQIVKGWVNNLSTDVFSDDNAVIQAIEAGQCDVGVVNTYYYGRLHKQNPNLPVKIFWPN
QGDRGVHVNLSGIGLTKHAPHPEAAKKLVEWMTGEEAQKLFADINQEFPANPKVKPSEEV
AAWGSFKADSIPVEIAGKRQAEAIRLMDRAGYN