Protein Info for PP_5179 in Pseudomonas putida KT2440

Annotation: spermidine/putrescine ABC transporter - ATP binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00005: ABC_tran" amino acids 39 to 180 (142 residues), 135.9 bits, see alignment E=2.3e-43 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 53 to 378 (326 residues), 427.9 bits, see alignment E=1.2e-132 PF08402: TOBE_2" amino acids 300 to 378 (79 residues), 64.6 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 100% identity to ppf:Pput_5086)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CK1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_5179 spermidine/putrescine ABC transporter - ATP binding subunit (Pseudomonas putida KT2440)
MAVASGAYKKALEGGQQPKQVLVKIDRVTKKFDETVAVDDVSLEIRKGEIFALLGGSGSG
KSTLLRMLAGFERPSEGRIFLDGVDITDMPPYERPINMMFQSYALFPHMTVAQNIAFGLQ
QDKMPKAEIDARVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPM
GALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGWIAQIGSPVDI
YETPTSRLVCEFIGNVNLFEGDVVDDAEGYAIIASPELERKIYVGHGITTSVEDKHITYA
LRPEKMLVTTQQPTCEHNWSRGKIHDIAYLGGHSVFYVELPSGKVVQSFVANAERQGTRP
TWGDEVYVWWEDDSGVVLRS