Protein Info for PP_5141 in Pseudomonas putida KT2440

Annotation: Thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 2 to 323 (322 residues), 283.9 bits, E=5.3e-89
• TIGR03284: thymidylate synthase
  • amino acids 153 to 323 (171 residues), 125.6 bits, E=1.1e-40

Best Hits

Swiss-Prot: 100% identical to TYSY_PSEPK: Thymidylate synthase (thyA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to ppu:PP_5141)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleosides salvage (1/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

See Q88CN9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PP_5141 Thymidylate synthase (Pseudomonas putida KT2440)
MKQYLDLVRDVIDNGTLQGNRTGIRTISLPGAMLRFDLQKGFPAITTRKLAFKSAIGEMV
GFLRGVKNAGEFRELGCKVWDQNANENAQWLANPFRQGHDDLGEIYGVQWRQWPGYKRIP
LSNPAAIEMAEQAGFRRIAQDEEDGVAFVILYKAIDQVRQCLDTIANDPGSRRILFHGWN
CAQLDEMALPPCHLLYQFHPNVETREISLTLYIRSNDLGLGTPFNLTEGAALLSLFGRLT
GYTPRWFTYFIGDAHVYENHLDMLNEQLKREPLEAPKLVISDRVPAFAETGKYEPEWLEK
IEPSDFWLEGYEHHAPMTAPMAV