Protein Info for PP_5114 in Pseudomonas putida KT2440

Annotation: putative adenine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD
  • amino acids 16 to 199 (184 residues), 188.3 bits, E=5.7e-60
• PF03602: Cons_hypoth95
  • amino acids 21 to 198 (178 residues), 209.3 bits, E=9.6e-66
• PF06325: PrmA
  • amino acids 61 to 135 (75 residues), 26.1 bits, E=1.5e-09
• PF13847: Methyltransf_31
  • amino acids 62 to 153 (92 residues), 27.3 bits, E=6.8e-10
• PF05175: MTS
  • amino acids 62 to 145 (84 residues), 32.3 bits, E=1.9e-11
• PF13649: Methyltransf_25
  • amino acids 65 to 141 (77 residues), 27.2 bits, E=1.3e-09

Best Hits

Swiss-Prot: 49% identical to RSMD_ECOLI: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli (strain K12)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 100% identity to ppu:PP_5114)

MetaCyc: 49% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.171

Sequence Analysis Tools

See Q88CR6 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PP_5114 putative adenine methyltransferase (Pseudomonas putida KT2440)
MPRSTPPARPQAGQSKGQGHLRIIAGEWRSRRLAVPEGEGLRPTPDRVRETVFNWLAPYI
EGARVLDAFTGSGALVLEALSRGAEDAVALDSNPAAIANLKNNLEILRCPRGQILQTDAL
RYLQGPAKQQFDVVFLDPPFHQDLLANTCNMLEQNQWLGEQAWVYTESEAAPSTLQLPGN
WRLHREKKTGQVHYALWQRG