Protein Info for PP_5104 in Pseudomonas putida KT2440

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF05690: ThiG" amino acids 12 to 264 (253 residues), 363.1 bits, see alignment E=3.4e-113

Best Hits

Swiss-Prot: 100% identical to THIG_PSEP1: Thiazole synthase (thiG) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to ppu:PP_5104)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CS6 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PP_5104 thiazole synthase (Pseudomonas putida KT2440)
MSNVRSDKPFTLAGRTFQSRLLVGTGKYRDMEETRLATEASGAEIVTVAVRRTNLGQNAG
EPNLLDVLSPDKYTILPNTAGCFDAVEAVRTCRLARELLDGRKSHESRTLVKLEVLADQK
TLFPNVIETLKAAEVLVKEGFDVMVYTSDDPIIARQLAEVGCIAVMPLAGLIGTGLGICN
PYNLQIILEESKVPVLVDAGVGTASDATIAMEMGCEAVLMNSAIAHAQQPVLMAEAMKHA
IVAGRMAYLAGRMPKKLYASASSPLDGLIK