Protein Info for PP_5087 in Pseudomonas putida KT2440

Annotation: ribosomal protein L31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR00105: ribosomal protein bL31" amino acids 30 to 95 (66 residues), 112.6 bits, see alignment E=3.5e-37 PF01197: Ribosomal_L31" amino acids 30 to 94 (65 residues), 106.3 bits, see alignment E=3.6e-35

Best Hits

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 100% identity to ppf:Pput_4960)

Predicted SEED Role

"LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-dependent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>PP_5087 ribosomal protein L31 (Pseudomonas putida KT2440)
MCSGIIRRLITCGIQQLVLGGGTQLEEVTMKEGIHPNYEVVAVTCSCGNKFETRSTLGNV
LSIDVCNLCHPFYTGKQKVLDTGGRVQKFADRFGMFGAKK