Protein Info for PP_5063 in Pseudomonas putida KT2440

Annotation: betaine aldehyde dehydrogenase, NAD-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR01804: betaine-aldehyde dehydrogenase" amino acids 10 to 477 (468 residues), 754.6 bits, see alignment E=1.6e-231 PF00171: Aldedh" amino acids 16 to 479 (464 residues), 601.7 bits, see alignment E=4e-185

Best Hits

Swiss-Prot: 100% identical to BETB_PSEPK: NAD/NADP-dependent betaine aldehyde dehydrogenase (betB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00130, betaine-aldehyde dehydrogenase [EC: 1.2.1.8] (inferred from 100% identity to ppf:Pput_4936)

MetaCyc: 76% identical to betaine aldehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Betaine-aldehyde dehydrogenase. [EC: 1.2.1.8]

Predicted SEED Role

"Betaine aldehyde dehydrogenase (EC 1.2.1.8)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CW7 at UniProt or InterPro

Protein Sequence (490 amino acids)

>PP_5063 betaine aldehyde dehydrogenase, NAD-dependent (Pseudomonas putida KT2440)
MARFGTQKLYIDGAYVDAGSDATFEAINPATGEVLAHVQRATEADVEKAVESAERGQKVW
AAMTAMQRSRILRRAVDILRERNDELAMLETLDTGKSYSETRYVDIVTGADVLEYYAGLV
PAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEV
TSLTTLKLAEIYTEAGLPNGVFNVLTGSGREVGTWLTEHPRIEKVSFTGGTTTGKKVMAS
ASSSSLKEVTMELGGKSPLIICADADLDKAADIAMMANFYSSGQVCTNGTRVFIPAEMKA
AFEAKIAERVARIRVGNPEDENTNFGPLVSFQHMESVLGYIAKGKEEGARVLCGGERLTA
GDFAKGAFVAPTVFTDCTDDMTIVKEEIFGPVMSILTYETEEEVIRRANDTDYGLAAGVC
TNDITRAHRIIHKLEAGICWINAWGESPAEMPVGGYKQSGVGRENGVSSLAQYTRIKSVQ
VELGGYNSVF