Protein Info for PP_5058 in Pseudomonas putida KT2440

Annotation: Carboxy-terminal-processing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF22694: CtpB_N-like" amino acids 38 to 93 (56 residues), 38.2 bits, see alignment 4e-13 TIGR00225: C-terminal processing peptidase" amino acids 63 to 383 (321 residues), 348.7 bits, see alignment E=1.5e-108 PF00595: PDZ" amino acids 107 to 176 (70 residues), 41.4 bits, see alignment E=3.8e-14 PF13180: PDZ_2" amino acids 109 to 180 (72 residues), 42.7 bits, see alignment E=1.4e-14 PF17820: PDZ_6" amino acids 124 to 178 (55 residues), 51 bits, see alignment 2.5e-17 PF03572: Peptidase_S41" amino acids 206 to 372 (167 residues), 195.3 bits, see alignment E=1.4e-61

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to ppu:PP_5058)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CX2 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PP_5058 Carboxy-terminal-processing protease (Pseudomonas putida KT2440)
MLHSPRLTQLALSIALAVGAPLATAAEPAKAAAVPATEVTAKAPLPLEELRTFAEVLDRI
KAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFQELQESTSGEFGGLGIEVGQEDG
FIKVVSPIDDTPASRAGVQAGDLIVKINGAPTRGQTMTEAVDKMRGKVGEKITLTLVRDG
GNPFDVNLTRAVIQVKSVKSQLLENDYGYIRITQFQVKTGDEVGKALAKLRKDNGKKLRG
VVLDLRNNPGGVLQSAVEVADHFLTKGLIVYTKGRIANSELRFSADPADASAGVPLVVLI
NGGSASASEIVAGALQDQKRAVLMGTDSFGKGSVQTVLPLANDRALKLTTALYYTPNGRS
IQAQGIVPDIEVRPAKLTAEADTENFKEADLQGHLGNGNGGADRPTGSSKRKERPQDDDF
QLSQALSLLKGLNITKGD