Protein Info for PP_5054 in Pseudomonas putida KT2440

Annotation: glutaredoxin 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 84 TIGR02181: glutaredoxin 3" amino acids 4 to 82 (79 residues), 123.3 bits, see alignment E=1.9e-40 PF00462: Glutaredoxin" amino acids 4 to 63 (60 residues), 75.1 bits, see alignment E=6.1e-25 PF13417: GST_N_3" amino acids 7 to 61 (55 residues), 29.4 bits, see alignment E=1.2e-10 PF13409: GST_N_2" amino acids 11 to 63 (53 residues), 26.3 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 70% identical to GLRX_PSEAE: Glutaredoxin (grx) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03676, glutaredoxin 3 (inferred from 99% identity to ppg:PputGB1_5105)

MetaCyc: 56% identical to reduced glutaredoxin 3 (Escherichia coli K-12 substr. MG1655)
Protein-disulfide reductase (glutathione). [EC: 1.8.4.2]

Predicted SEED Role

"Glutaredoxin 3 (Grx3)" in subsystem Glutaredoxins or Glutathione: Redox cycle

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CX6 at UniProt or InterPro

Protein Sequence (84 amino acids)

>PP_5054 glutaredoxin 3 (Pseudomonas putida KT2440)
MKPVIVYSSDYCPYCMRAKYLLESKGVAFEEIKVDGKPQVRAEMSQKAGRTSVPQIWIGS
THVGGCDDLYALERAGKLDALLAA