Protein Info for PP_5053 in Pseudomonas putida KT2440

Annotation: Protein-export protein SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF02556: SecB" amino acids 12 to 150 (139 residues), 188.6 bits, see alignment E=2.7e-60 TIGR00809: protein-export chaperone SecB" amino acids 13 to 147 (135 residues), 179.4 bits, see alignment E=1.8e-57

Best Hits

Swiss-Prot: 100% identical to SECB_PSEP1: Protein-export protein SecB (secB) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 100% identity to ppu:PP_5053)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CX7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PP_5053 Protein-export protein SecB (Pseudomonas putida KT2440)
MTDQQTNGAAAEDNSPQFSLQRIYVRDLSFEAPKSPQIFRQTWEPSVALDLNTKQKSLEG
DFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIANLDAPSMSHTLGAFCPNILFPYAREA
LDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEAPTVQ