Protein Info for PP_5048 in Pseudomonas putida KT2440

Annotation: two-component system DNA-binding transcriptional dual regulator GlnL/GlnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 463 (457 residues), 789.6 bits, see alignment E=4.6e-242 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 104.5 bits, see alignment E=1.1e-33 PF00158: Sigma54_activat" amino acids 141 to 308 (168 residues), 241.6 bits, see alignment E=1.1e-75 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 72.6 bits, see alignment E=1.2e-23 PF07728: AAA_5" amino acids 165 to 284 (120 residues), 30.9 bits, see alignment E=7.7e-11 PF25601: AAA_lid_14" amino acids 314 to 392 (79 residues), 78.3 bits, see alignment E=9.4e-26 PF02954: HTH_8" amino acids 424 to 463 (40 residues), 48 bits, see alignment 2.4e-16

Best Hits

Swiss-Prot: 69% identical to NTRC_SALTY: DNA-binding transcriptional regulator NtrC (glnG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to ppf:Pput_4923)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CY1 at UniProt or InterPro

Protein Sequence (478 amino acids)

>PP_5048 two-component system DNA-binding transcriptional dual regulator GlnL/GlnG (Pseudomonas putida KT2440)
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMGRLARQQPDVIISDIRMPG
TSGLDLLAQIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRAN
QHAQEQQGLDVPQNLARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAH
ALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLD
EIGDMPADTQTRLLRVLADGEFYRVGGHVPVKVDVRIIAATHQNLESLVQAGKFREDLFH
RLNVIRIHIPRLADRREDIPALARHFLARAAQELAVEPKILKPETEEFIRNLPWPGNVRQ
MENTCRWITVMASSREVLIGDLPPELLNLPHDAAPVTNWEQALRQWADQALARGQTSLLD
SAVPSFERIMIETALKHTAGRRRDAALLLGWGRNTLTRKIKELGMNVAGGDDEEGDDH