Protein Info for PP_5047 in Pseudomonas putida KT2440

Annotation: two-component system sensory histidine kinase/phosphatase GlnL/GlnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00989: PAS" amino acids 9 to 106 (98 residues), 29.2 bits, see alignment E=1.6e-10 PF08448: PAS_4" amino acids 12 to 109 (98 residues), 25.6 bits, see alignment E=2.5e-09 PF00512: HisKA" amino acids 136 to 189 (54 residues), 56.9 bits, see alignment 3.6e-19 PF02518: HATPase_c" amino acids 237 to 355 (119 residues), 62 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to ppf:Pput_4922)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CY2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PP_5047 two-component system sensory histidine kinase/phosphatase GlnL/GlnG (Pseudomonas putida KT2440)
MTISDAQHRLLLDNLTTATLLLNAELRLEYMNPAAEMLLAVSGQRSHGQFISELFTESTE
ALSSLRQAVEQAHPFTKREAQLTSLTGQTITVDYAVTPILHQGQTLLLLEVHPRDRLLRI
TKEEAQLSKQETTKMLVRGLAHEIKNPLGGIRGAAQLLARELPEEGLRDYTNVIIEEADR
LRNLVDRMLGSNKLPSLAMTNIHEVLERVCSLVDAESQGCITLVRDYDPSLPDVLIDREQ
MIQAVLNIVRNAMQAISSQNELRLGRITLRSRALRQFTIGHVRHRLVARVEIIDNGPGIP
PELQETLFYPMVSGRPDGTGLGLAITQNIISQHQGLIECESHAGHTAFSIYLPLEQGATA
S