Protein Info for PP_5045 in Pseudomonas putida KT2440

Annotation: tRNA sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 371 (368 residues), 336.5 bits, see alignment E=2e-104 PF22025: ThiI_fer" amino acids 9 to 78 (70 residues), 35.1 bits, see alignment E=3.6e-12 PF02926: THUMP" amino acids 88 to 164 (77 residues), 47.1 bits, see alignment E=6.5e-16 PF02568: ThiI" amino acids 179 to 370 (192 residues), 202.4 bits, see alignment E=1.4e-63 TIGR04271: thiazole biosynthesis domain" amino acids 385 to 483 (99 residues), 117.4 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 100% identical to THII_PSEPK: tRNA sulfurtransferase (thiI) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 100% identity to ppf:Pput_4919)

MetaCyc: 51% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CY4 at UniProt or InterPro

Protein Sequence (484 amino acids)

>PP_5045 tRNA sulfurtransferase (Pseudomonas putida KT2440)
MKLIVKVFPEITIKSRPVRKRFIRQLGKNIRNVLKDLDPELAVDGVWDNLEVVTRVEDEK
VQREMIERLTCTPGITHFLQVEEYPLGDFDDIVAKCKHHFGHLLAGKHFAVRCKRGGHHD
FTSMDVDRYVGSQLRQQCGAAGIELKKPEVLVRIEIRDQRLYVIHNQHNGIGGYPLGALE
QTLVLMSGGFDSTVAAYQMMRRGLMTHFCFFNLGGRAHELGVMEVAHYLWKKYGSSQRVL
FISVPFEEVVGEILNKVDNSYMGVTLKRMMLRGAAHMADRLQIDALVTGEAISQVSSQTL
PNLSIIDSATDKLVLRPLLASHKQDIIDQATEIGTADFAKHMPEYCGVISVNPTTHAKRH
RMEHEEKQFDMAVLERALERAKFISIDHVIDELGKDIEIEEVAEALPGQIVIDIRHPDAQ
EDEPLVLEGIEVQAMPFYAINSKFKHLDPTRQYLLYCDKGVMSRLHAHHLLSEGHANVRV
YRPT