Protein Info for PP_5044 in Pseudomonas putida KT2440

Annotation: ribosome associated GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00009: GTP_EFTU" amino acids 4 to 195 (192 residues), 193.4 bits, see alignment E=8.8e-61 TIGR01394: GTP-binding protein TypA/BipA" amino acids 5 to 599 (595 residues), 939.7 bits, see alignment E=5.7e-287 TIGR00231: small GTP-binding protein domain" amino acids 5 to 139 (135 residues), 83.1 bits, see alignment E=2e-27 PF01926: MMR_HSR1" amino acids 8 to 129 (122 residues), 27.7 bits, see alignment E=7.5e-10 PF22042: EF-G_D2" amino acids 205 to 289 (85 residues), 29 bits, see alignment E=2.8e-10 PF03144: GTP_EFTU_D2" amino acids 219 to 289 (71 residues), 42.6 bits, see alignment E=2e-14 PF00679: EFG_C" amino acids 397 to 477 (81 residues), 77.3 bits, see alignment E=2.3e-25 PF21018: BipA_C" amino acids 485 to 594 (110 residues), 155.1 bits, see alignment E=1.5e-49

Best Hits

Swiss-Prot: 72% identical to TYPA_ECO57: GTP-binding protein TypA/BipA (typA) from Escherichia coli O157:H7

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to ppf:Pput_4918)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CY5 at UniProt or InterPro

Protein Sequence (606 amino acids)

>PP_5044 ribosome associated GTPase (Pseudomonas putida KT2440)
MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDSNDQEKERGITILAKN
TAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDGPMPQTRFVTKKAFEAG
LKPIVVINKVDRPGARPDWVLDQIFDLFDNLGATDEQLDFKVVYASALNGIAGLDHTAMA
EDMTPLYQSIVDNVPAPSVDRDGPFQMQISALDYNSFLGVIGVGRIARGRVKPNTPVVAI
DTNGKKRNGRILKLMGHHGLHRVDVEEAQAGDIVCISGFDELFISDTLCAPDAVEAMKPL
TVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKDRLDKELLYNVALRVQETDSPDKFKVSG
RGELHLSVLIETMRREGFEMAVGRPEVIIREVDGVKQEPFENVTIDIPEESQGKVMEEMG
LRKGDLTNMVPDGKGRVRLEYNIPARGLIGFRNQFLTLTNGAGILTSIFDRYDTMKSGQM
SGRLNGVLVSVETGKALTYSLETLQARGKLFVEHGQEIYNGQIIGLNSRDNDLGVNPTKG
KKLDNMRASGKDEVIALVPPVRHTLEQALEFIQDDELCEVTPKSIRLRKKILDEGERTRA
AKKAKN