Protein Info for PP_5028 in Pseudomonas putida KT2440

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR01249: prolyl aminopeptidase" amino acids 46 to 348 (303 residues), 435.3 bits, see alignment E=5.8e-135 PF00561: Abhydrolase_1" amino acids 73 to 333 (261 residues), 135.8 bits, see alignment E=3.2e-43 PF12697: Abhydrolase_6" amino acids 74 to 332 (259 residues), 56.6 bits, see alignment E=8.8e-19 PF12146: Hydrolase_4" amino acids 94 to 331 (238 residues), 48.2 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 57% identical to PIP_LEPBY: Probable proline iminopeptidase (pip) from Leptolyngbya boryana

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to ppu:PP_5028)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D01 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PP_5028 proline iminopeptidase (Pseudomonas putida KT2440)
MRKGQFAPFERVSKDGAESAIQVYDGPRPNNPHTECAMQTLYPQIKPYARHDLAVEAPHV
LYVDESGSPEGLPVVFIHGGPGAGCDAQSRCYFDPNLYRIITFDQRGCGRSTPHASLENN
TTWHLVEDLERIREHLGIDKWVLFGGSWGSTLALAYAQAHPERVHGLILRGIFLCRPQEI
EWFYQEGASRLFPDYWQDYIAPIPPEERGDLVRAFHKRLTGNDQIAQMHAAKAWSTWEGR
TATLRPNPLVVDRFSEPQRALSIARIECHYFMNNAFLEPDQLIRDLPKIAHLPAVIVHGR
YDVICPLDNAWALHQAWPNSELKVIRDAGHAASEPGITDALVRAADQMARRLLDLPLEEA