Protein Info for PP_5027 in Pseudomonas putida KT2440

Annotation: D-tyrosyl-tRNA(Tyr) deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 TIGR00256: D-tyrosyl-tRNA(Tyr) deacylase" amino acids 1 to 144 (144 residues), 183.2 bits, see alignment E=1.9e-58 PF02580: Tyr_Deacylase" amino acids 3 to 144 (142 residues), 184.9 bits, see alignment E=5e-59

Best Hits

Swiss-Prot: 100% identical to DTD_PSEPK: D-aminoacyl-tRNA deacylase (dtd) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07560, D-tyrosyl-tRNA(Tyr) deacylase [EC: 3.1.-.-] (inferred from 98% identity to ppg:PputGB1_5077)

MetaCyc: 54% identical to D-aminoacyl-tRNA deacylase (Escherichia coli K-12 substr. MG1655)
RXN-15041 [EC: 3.1.1.96]; 3.1.1.96 [EC: 3.1.1.96]; 3.1.1.96 [EC: 3.1.1.96]; 3.1.1.96 [EC: 3.1.1.96]; 3.1.1.96 [EC: 3.1.1.96]

Predicted SEED Role

"D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)" (EC 3.6.1.n1)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.1.1.96 or 3.6.1.n1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D02 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PP_5027 D-tyrosyl-tRNA(Tyr) deacylase (Pseudomonas putida KT2440)
MRGLLQRVRGARVEVAGEVVGAIDQGLLVLVAVEPEDSREQADKLLHKLLNYRVFSDEQG
KMNLSLKDVGGGLLLVSQFTLAADTRNGMRPSFSTAAPPALGAELFDYLLQQAKAQYADV
ASGRFGADMQVHLVNDGPVTFMLQI