Protein Info for PP_5017 in Pseudomonas putida KT2440

Annotation: Sec-independent protein translocase protein TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF02416: TatA_B_E" amino acids 2 to 49 (48 residues), 66.6 bits, see alignment E=5.7e-23 TIGR01410: twin arginine-targeting protein translocase TatB" amino acids 2 to 75 (74 residues), 81 bits, see alignment E=3.5e-27

Best Hits

Swiss-Prot: 65% identical to TATB_PSEAE: Sec-independent protein translocase protein TatB (tatB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 100% identity to ppu:PP_5017)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D12 at UniProt or InterPro

Protein Sequence (125 amino acids)

>PP_5017 Sec-independent protein translocase protein TatB (Pseudomonas putida KT2440)
MFGMSFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNSIKMEVEREIGADDIR
RQLHNEHILQMEEEAKRILNPMTPPAQPPVTTASVQPPAGLEAKPVEAPAAPAAPSEPPQ
PPRAP