Protein Info for PP_5008 in Pseudomonas putida KT2440

Annotation: Poly granule-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF05597: Phasin" amino acids 11 to 136 (126 residues), 144.2 bits, see alignment E=1.1e-46 TIGR01837: poly(hydroxyalkanoate) granule-associated protein" amino acids 18 to 138 (121 residues), 156.4 bits, see alignment E=1.5e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4882)

Predicted SEED Role

"polyhydroxyalkanoate granule-associated protein PhaI" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D20 at UniProt or InterPro

Protein Sequence (139 amino acids)

>PP_5008 Poly granule-associated protein (Pseudomonas putida KT2440)
MAKVIAKKKDEALDTLGEVRGYARKIWLAGIGAYARVGQEGADYFKELVRAGEGVEKRGK
KRIDKELDAANHQLDEVGEEVSRVRGKVEIQLDKIEKAFDARVGRALNRLGIPSKHDVEA
LSIKLEQLHELLERVAHKP