Protein Info for PP_5004 in Pseudomonas putida KT2440

Annotation: Poly(3-hydroxyalkanoate) depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 190 to 206 (17 residues), see Phobius details TIGR02240: poly(3-hydroxyalkanoate) depolymerase" amino acids 4 to 279 (276 residues), 629 bits, see alignment E=4.3e-194 PF00561: Abhydrolase_1" amino acids 30 to 254 (225 residues), 147.3 bits, see alignment E=9.4e-47 PF12146: Hydrolase_4" amino acids 32 to 245 (214 residues), 41.7 bits, see alignment E=1.3e-14 PF12697: Abhydrolase_6" amino acids 34 to 260 (227 residues), 61 bits, see alignment E=4.2e-20

Best Hits

Swiss-Prot: 97% identical to PHAZ_PSEOL: Poly(3-hydroxyalkanoate) depolymerase (phaZ) from Pseudomonas oleovorans

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5004)

MetaCyc: 99% identical to intracellular poly(3-hydroxyoctanoate) depolymerase (Pseudomonas putida KT2442)
Poly(3-hydroxyoctanoate) depolymerase. [EC: 3.1.1.76]

Predicted SEED Role

"Poly(3-hydroxyalkanoate) depolymerase" in subsystem Polyhydroxybutyrate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D24 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PP_5004 Poly(3-hydroxyalkanoate) depolymerase (Pseudomonas putida KT2440)
MPQPYIFRTVELDNQSIRTAVRPGKPHLTPLLIFNGIGANLELVFPFIDALDPDLEVIAF
DVPGVGGSSTPRNPYRFPGLAKLTARMLDYLDYGQVNVIGVSWGGALAQQFAHDYPERCK
KLVLAATAAGAVMVPGKPKVLWMMASPRRYVQPSHVIRIAPMIYGGGFRRDPDLAMHHAA
KVRSGGKLGYYWQLFAGLGWTSIHWLHKIRQPTLVLAGDDDPLIPLINMRLLAWRIPNAQ
LHIIDDGHLFLITRAEAVAPIIMKFLQEERQRAVMHPRPASGG