Protein Info for PP_5001 in Pseudomonas putida KT2440

Annotation: protease HslVU, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 3 to 447 (445 residues), 696.9 bits, see alignment E=6.1e-214 PF07728: AAA_5" amino acids 51 to 88 (38 residues), 26.7 bits, see alignment 1.5e-09 PF00004: AAA" amino acids 52 to 139 (88 residues), 33.5 bits, see alignment E=1.7e-11 amino acids 237 to 332 (96 residues), 28.8 bits, see alignment E=4.4e-10 PF07724: AAA_2" amino acids 187 to 329 (143 residues), 93.7 bits, see alignment E=4.1e-30

Best Hits

Swiss-Prot: 100% identical to HSLU_PSEP1: ATP-dependent protease ATPase subunit HslU (hslU) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to ppu:PP_5001)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D27 at UniProt or InterPro

Protein Sequence (447 amino acids)

>PP_5001 protease HslVU, ATPase component (Pseudomonas putida KT2440)
MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGV
GKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRH
RAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVAD
AVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELK
AKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTD
HILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLK
TEGLNIEFLADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEA
PIQIDAAYVNSHLGELAQNEDLSRYIL