Protein Info for PP_5000 in Pseudomonas putida KT2440

Annotation: peptidase component of the ATP-dependent HslVU protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 2 to 171 (170 residues), 287.2 bits, E=1.9e-90
• PF00227: Proteasome
  • amino acids 2 to 170 (169 residues), 87.8 bits, E=3.8e-29

Best Hits

Swiss-Prot: 100% identical to HSLV_PSEPK: ATP-dependent protease subunit HslV (hslV) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to ppu:PP_5000)

MetaCyc: 78% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See Q88D28 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PP_5000 peptidase component of the ATP-dependent HslVU protease (Pseudomonas putida KT2440)
MTTIVSVRRNGKVVMGGDGQVSLGNTVMKGNAKKVRRLYHGQVIAGFAGATADAFTLFER
FEGQLEKHQGHLVRAAVELAKEWRTDRSLSRLEAMLAVANKDASLIITGNGDVVEPEDGL
IAMGSGGAYAQAAARALLNKTDLSAREIAETALNIAGDICVFTNHNLTIEEQDLAD