Protein Info for PP_4999 in Pseudomonas putida KT2440

Annotation: dihydroorotase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 22 to 421 (400 residues), 290.8 bits, see alignment E=8.7e-91 PF01979: Amidohydro_1" amino acids 158 to 419 (262 residues), 42.9 bits, see alignment E=3.8e-15 PF07969: Amidohydro_3" amino acids 342 to 419 (78 residues), 31 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 96% identical to PYRX_PSEPU: Dihydroorotase-like protein (pyrC') from Pseudomonas putida

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 99% identity to ppg:PputGB1_5049)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D29 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PP_4999 dihydroorotase-like protein (Pseudomonas putida KT2440)
MTISILGARVIDPNSGLDQVTDLHLDGGRIVAIGAAPAGFSASRTIQADGLVAAPGLVDL
GVSLREPGYSRKGNIASETRAAVAGGVTSLCCPPQTKPVLDTSAVAELILDRAREAANSK
VYPVGALTKGLEGEQLAELVALRDTGCVAFGNGLKEIPNNRTLARALEYAATFDLTVVFH
SQDRDLAQGGLAHEGAMASFLGLPGIPESAETVALARNLLLVEQSGVRAHFSQITSARGA
RLIAQAQALGLPVTADVALYQLILTDESLREFSSLYHVQPPLRTAADRDGLREAVKSGVI
QAISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVQDGLLDLPTLLARLSSGPAA
ALRLPAGELKVGGAADLVLFDPQASTVAGEQWFSRGENCPFIGHCLPGAVRYTLVDGHIC
HEA