Protein Info for PP_4993 in Pseudomonas putida KT2440

Annotation: Glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01380: glutathione synthase" amino acids 4 to 313 (310 residues), 450.4 bits, see alignment E=1.4e-139 PF02951: GSH-S_N" amino acids 4 to 121 (118 residues), 162 bits, see alignment E=8.6e-52 PF02955: GSH-S_ATP" amino acids 125 to 297 (173 residues), 260.9 bits, see alignment E=6.5e-82 PF08443: RimK" amino acids 154 to 310 (157 residues), 40.3 bits, see alignment E=4e-14

Best Hits

Swiss-Prot: 100% identical to GSHB_PSEPK: Glutathione synthetase (gshB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 99% identity to ppf:Pput_4867)

MetaCyc: 67% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D35 at UniProt or InterPro

Protein Sequence (317 amino acids)

>PP_4993 Glutathione synthetase (Pseudomonas putida KT2440)
MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGEGKARARMRPLKV
FADPARWFELGEEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL
RDCNEKMFATLFPQCTTPTLVSRRPDIIREFTAKHADVILKPLDGMGGTSIFRHRAGDPN
LSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG
GRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAYNT
DIGGKLMDAIDRKLKAR