Protein Info for PP_4981 in Pseudomonas putida KT2440

Annotation: polyisoprene-binding protein, acidic stress response factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF04264: YceI" amino acids 38 to 199 (162 residues), 153.5 bits, see alignment E=2.8e-49

Best Hits

Swiss-Prot: 100% identical to Y4981_PSEPK: UPF0312 protein PP_4981 (PP_4981) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4981)

Predicted SEED Role

"Protein yceI precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D47 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PP_4981 polyisoprene-binding protein, acidic stress response factor (Pseudomonas putida KT2440)
MTLNLNYTGRNRMLKKTFAALALGTALLSAGQAMAAEYKIDKEGQHAFVDWKISHLGYSF
IHGTFKDFDGNFSWDSAKPEASKISVDLKTASLWSNHAERDKHIASADFLDVKKYPDAKF
VSTSVKSTGDKTADVTGDLTMHGVTKPVTFKATFNGEGKDPWGGERAGFNATTTLNLNDF
GIKGPGATSQTLDLDISVEGVKQK